| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK090306.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
| KASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,577.233 | ||
| Theoretical pI: | 7.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 33.841 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.226 | ||
| sheet | 0.247 | ||