Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK244676.1 | internal | 160 | 2-481(+) |
Amino Acid sequence : | |||
YKLTYYTPDYVPKDTDTLAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPIAYIKTFPGPPHGIQVERNKLNKYGPPLLGCGIKQKLG | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,686.933 | ||
Theoretical pI: | 5.447 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 27.891 | ||
aromaticity | 0.119 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.244 | ||
sheet | 0.231 |