Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK244685.1 | internal | 157 | 3-473(+) |
Amino Acid sequence : | |||
FRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVER DKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGG | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,257.440 | ||
Theoretical pI: | 8.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
Instability index: | 35.333 | ||
aromaticity | 0.108 | ||
GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.261 | ||
sheet | 0.248 |