Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK285277.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,705.412 | ||
Theoretical pI: | 9.020 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 20.177 | ||
aromaticity | 0.118 | ||
GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.215 | ||
sheet | 0.237 |