Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK285279.1 | internal | 192 | 1-576(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLEFYK | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,443.254 | ||
Theoretical pI: | 8.993 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31985 | ||
Instability index: | 22.200 | ||
aromaticity | 0.125 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.214 | ||
sheet | 0.240 |