Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK301473.1 | internal | 185 | 1-555(+) |
Amino Acid sequence : | |||
TETKASAGFKAGVKDYRLTYYTPDHETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,314.740 | ||
Theoretical pI: | 7.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 23.356 | ||
aromaticity | 0.108 | ||
GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.222 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK301473.1 | internal | 185 | 1-555(+) |
Amino Acid sequence : | |||
TETKASAGFKAGVKDYRLTYYTPDHETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,314.740 | ||
Theoretical pI: | 7.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 23.356 | ||
aromaticity | 0.108 | ||
GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.222 | ||
sheet | 0.254 |