| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK301474.1 | internal | 185 | 1-555(+) |
Amino Acid sequence : | |||
| TETKASAGFKAGVKDYRLTYYTPDHETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,314.740 | ||
| Theoretical pI: | 7.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 23.356 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.222 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK301474.1 | internal | 185 | 1-555(+) |
Amino Acid sequence : | |||
| TETKASAGFKAGVKDYRLTYYTPDHETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,314.740 | ||
| Theoretical pI: | 7.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 23.356 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.222 | ||
| sheet | 0.254 | ||