| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK442922.1 | complete | 357 | 58-1131(+) |
Amino Acid sequence : | |||
| MRSMNLMDAWVQNLSIFKQPHPSKSLLGFINHPRFEPVFLKSRKAIGVSAVLTGEEARISTQPFNFNAYVVEKANHVNKALDEAVAVRNPPMIHEAMRYSLLAGGKRVRPMLCIAACEIV GGPQAAAIPAACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALLAFAFEFMATATEEVAPERILAAVGELAKAIGTEGLVAGQVVDINCTGDANVGLDTLEFIHI HKTAALLEASVVLGAILGGGSSDQVEKLRTFARKIGLLFQVVDDILDVTKSSEELGKTAGKDLVVDKTTYPKLLGLEKAVEFAEKLNEEAKAQLAEFDPDKAAPLAALADYIAHRQN* | |||
Physicochemical properties | |||
| Number of amino acids: | 357 | ||
| Molecular weight: | 16,177.362 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
| Instability index: | 80.540 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.350 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK442922.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
| PSTDLPELFLAQNPKFTNHEVYESDGCLGPEPLNLQAASPLQIPARIHQPPQIRTCFPEITQGHRRLRRPDRRGGQNLDSALQFQRLRGGEGESRQQGAGRGGGGEKPADDPRGDALLAP RRREARAPHALHRRLRDRRRTPGGGNPGRLRGGDDPHHVAHPRRSPLYGQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 16,177.362 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
| Instability index: | 80.540 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.350 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK442922.1 | complete | 157 | 824-351(-) |
Amino Acid sequence : | |||
| MAPKTTEASSNAAVLCMWMNSNVSNPTFASPVQLMSTTCPATSPSVPIAFASSPTAASILSGATSSVAVAMNSKAKANRASPASTATSSPKTLWLVGLPRRRSSLSIQGRSSWMSDMVWI ISTAQAAGIAAAWGPPTISQAAMQSMGRTRFPPARSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 16,177.362 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
| Instability index: | 80.540 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.350 | ||
| sheet | 0.287 | ||