Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK520310.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
NLDSRHLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYI RYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELS DSNIIDRFSRICRNISHYHSG | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 31,246.072 | ||
Theoretical pI: | 10.044 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 62910 63160 | ||
Instability index: | 46.258 | ||
aromaticity | 0.142 | ||
GRAVY | -0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.238 | ||
sheet | 0.211 |