| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK520311.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| ILIQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIR YQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLITELAKAKFCNVLGHPISKPIRAELSD SNIIDRFSRICRNISHYHSG | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 31,122.054 | ||
| Theoretical pI: | 10.044 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 62910 63160 | ||
| Instability index: | 45.657 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.231 | ||
| sheet | 0.208 | ||