Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK525669.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
KASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPPAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVX | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,192.875 | ||
Theoretical pI: | 9.226 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 18.974 | ||
aromaticity | 0.115 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.220 | ||
sheet | 0.236 |