Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK526182.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
KASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVX | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,133.781 | ||
Theoretical pI: | 8.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 25.472 | ||
aromaticity | 0.115 | ||
GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.225 | ||
sheet | 0.236 |