Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK526185.1 | internal | 184 | 1-552(+) |
Amino Acid sequence : | |||
KASXGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPVAYIKTFQGPPHGIQVERDKLNKYXGRPLLGCTIKPKLGLSAKNXXRXVX | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,757.375 | ||
Theoretical pI: | 8.668 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 26.458 | ||
aromaticity | 0.112 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.225 | ||
sheet | 0.236 |