Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK535001.1 | complete | 194 | 1950-2534(+) |
Amino Acid sequence : | |||
MYIRKRNVKFNLSDDSICYSLFMDLPMQFRPKEMVNELKMVYSFDPTKKARFGVFPRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFSNELYE MRFNMKTGFASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDLHAEAETGKKVQYSSYTSQ* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 13,054.848 | ||
Theoretical pI: | 9.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 46.322 | ||
aromaticity | 0.156 | ||
GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.239 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK535001.1 | complete | 192 | 1009-1587(+) |
Amino Acid sequence : | |||
MKIGDLKGFLGLLMVYLQQLRTKLKVLDVSYGHGTANTALVYHHGKLLALSEAVKPYVVKVLEDGDLQTLGMMDYDKRLTHSFTAHPKVDPTTGEXFTLGYSHTPRYLTYRVISEDGIMH DPVPITIPEPIMMHDFAITETYAIVSCGNTCKWIEETLVLYIGFNTQLALKEQGLLVILFICPVTKRVARCM* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 13,054.848 | ||
Theoretical pI: | 9.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 46.322 | ||
aromaticity | 0.156 | ||
GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.239 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK535001.1 | complete | 137 | 1-414(+) |
Amino Acid sequence : | |||
MAENCIVSVIPKPSKFLSSKLLDLVERVVVKLMHDASLLLQYLSVNFAPVRNETPPVKDLRVVHGYLPECWNGEFVRVGLNPKFDPVAGYHWFDGDGMIHGVCIKDGKSSYVSRYVPTSR LKQEEFFGAAVRHLLKV* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,054.848 | ||
Theoretical pI: | 9.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 46.322 | ||
aromaticity | 0.156 | ||
GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.239 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK535001.1 | complete | 109 | 1140-811(-) |
Amino Acid sequence : | |||
MVIDERCISGSMSIRDVQYFQFGSKLLEIDHKQSQKPLKVPNLHEFRREYKLNISLFLTGFNFPFPDKTKCATNFVNNYWPATQNLRSFHYFSMESVRKCPNEEYIYKL* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 13,054.848 | ||
Theoretical pI: | 9.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 46.322 | ||
aromaticity | 0.156 | ||
GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.239 | ||
sheet | 0.193 |