| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK535001.1 | complete | 194 | 1950-2534(+) |
Amino Acid sequence : | |||
| MYIRKRNVKFNLSDDSICYSLFMDLPMQFRPKEMVNELKMVYSFDPTKKARFGVFPRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFSNELYE MRFNMKTGFASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDLHAEAETGKKVQYSSYTSQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 13,054.848 | ||
| Theoretical pI: | 9.030 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.156 | ||
| GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.239 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK535001.1 | complete | 192 | 1009-1587(+) |
Amino Acid sequence : | |||
| MKIGDLKGFLGLLMVYLQQLRTKLKVLDVSYGHGTANTALVYHHGKLLALSEAVKPYVVKVLEDGDLQTLGMMDYDKRLTHSFTAHPKVDPTTGEXFTLGYSHTPRYLTYRVISEDGIMH DPVPITIPEPIMMHDFAITETYAIVSCGNTCKWIEETLVLYIGFNTQLALKEQGLLVILFICPVTKRVARCM* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 13,054.848 | ||
| Theoretical pI: | 9.030 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.156 | ||
| GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.239 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK535001.1 | complete | 137 | 1-414(+) |
Amino Acid sequence : | |||
| MAENCIVSVIPKPSKFLSSKLLDLVERVVVKLMHDASLLLQYLSVNFAPVRNETPPVKDLRVVHGYLPECWNGEFVRVGLNPKFDPVAGYHWFDGDGMIHGVCIKDGKSSYVSRYVPTSR LKQEEFFGAAVRHLLKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,054.848 | ||
| Theoretical pI: | 9.030 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.156 | ||
| GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.239 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK535001.1 | complete | 109 | 1140-811(-) |
Amino Acid sequence : | |||
| MVIDERCISGSMSIRDVQYFQFGSKLLEIDHKQSQKPLKVPNLHEFRREYKLNISLFLTGFNFPFPDKTKCATNFVNNYWPATQNLRSFHYFSMESVRKCPNEEYIYKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 13,054.848 | ||
| Theoretical pI: | 9.030 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.156 | ||
| GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.239 | ||
| sheet | 0.193 | ||