| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 579 | 1-1740(+) |
Amino Acid sequence : | |||
| MDYRLSSSSLFHFPSPGNRIFLKQSQVLAFQNQPSHQDHPTTKKKSIRINKGGSISRNRSLAAVFCDALDDLITRHSFDPDALHPSVDPHRVLRGNFAPVSELPPTPCRVVRGTIPSALA GGAYIRNGPNPNHLPSGAHHLFEGDGMLHSLLLPSSEGGHAPIFSSRFVETYKYLVERRAGRPIFLSVFSGLCGFTGIARALVFFFRVLTMQVDPTKGIGLANTSLQFSNGRLHALCEYD LPYVVRLSPEDGDISTVGRIENNVSTKSTTAHPKTDPVTGETFSFSYGPIQPYVTYSRYDCDGKKSGPDVPIFSFKEPSFVHDFAITEHYAVFPDIQIVMKPAEIVRGRRMIGPDLEKVP RLGLLPRYATSDSEMRWFDVPGFNMVHVVNAWEEEGGEVVVIVAPNVSPIENAIDRFDLLHVSVEMARIELKSGSVSRTLLSAENLDFGVIHRGYSGRKSRYAYLGVGDPMPKIRGVVKV DFELAGRGECVVARREFGVGCFGGEPFFVPASSKKSGGEEDDGYVVSYLHDEGKGESSFVVMDARSPELEILAEVVLPRRVPYGFHGLFVTEAELLSQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 579 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 154 | 1128-1592(+) |
Amino Acid sequence : | |||
| MVRRAGVQHGTRGERVGGGRRGGRGDRGAQREPDRERHRPVRPPPRVGGDGEDRAQERERVADASLGGESGFRGDSPGLFGEEEPVCLPRSRGSDAEDSRGGEGGLRAGRERGMRGGEEG VRRGMFRRRAVLCAGIIEEERRRGRRWVRSELLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 106 | 480-160(-) |
Amino Acid sequence : | |||
| MAALGGGEEEGVEHAIALEEVVGPGGEVVWVGTIADVGPTGEGRGDGAADDAARGRRELAHGGEVAAEDAVRIDGRVEGIGVEGVSGDEIVEGVAEDGGEGPVSAY* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 100 | 716-1018(+) |
Amino Acid sequence : | |||
| MTSPTSFASPRKTGTSQPSDASKTTSPQKVRPPTRRRIPSPERRSASATDPSSPTSRTPVTTATARNRAPTCPSSLSRNRLSSTTSRSPNTMPSSPTSRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 579 | 1-1740(+) |
Amino Acid sequence : | |||
| MDYRLSSSSLFHFPSPGNRIFLKQSQVLAFQNQPSHQDHPTTKKKSIRINKGGSISRNRSLAAVFCDALDDLITRHSFDPDALHPSVDPHRVLRGNFAPVSELPPTPCRVVRGTIPSALA GGAYIRNGPNPNHLPSGAHHLFEGDGMLHSLLLPSSEGGHAPIFSSRFVETYKYLVERRAGRPIFLSVFSGLCGFTGIARALVFFFRVLTMQVDPTKGIGLANTSLQFSNGRLHALCEYD LPYVVRLSPEDGDISTVGRIENNVSTKSTTAHPKTDPVTGETFSFSYGPIQPYVTYSRYDCDGKKSGPDVPIFSFKEPSFVHDFAITEHYAVFPDIQIVMKPAEIVRGRRMIGPDLEKVP RLGLLPRYATSDSEMRWFDVPGFNMVHVVNAWEEEGGEVVVIVAPNVSPIENAIDRFDLLHVSVEMARIELKSGSVSRTLLSAENLDFGVIHRGYSGRKSRYAYLGVGDPMPKIRGVVKV DFELAGRGECVVARREFGVGCFGGEPFFVPASSKKSGGEEDDGYVVSYLHDEGKGESSFVVMDARSPELEILAEVVLPRRVPYGFHGLFVTEAELLSQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 579 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 154 | 1128-1592(+) |
Amino Acid sequence : | |||
| MVRRAGVQHGTRGERVGGGRRGGRGDRGAQREPDRERHRPVRPPPRVGGDGEDRAQERERVADASLGGESGFRGDSPGLFGEEEPVCLPRSRGSDAEDSRGGEGGLRAGRERGMRGGEEG VRRGMFRRRAVLCAGIIEEERRRGRRWVRSELLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 106 | 480-160(-) |
Amino Acid sequence : | |||
| MAALGGGEEEGVEHAIALEEVVGPGGEVVWVGTIADVGPTGEGRGDGAADDAARGRRELAHGGEVAAEDAVRIDGRVEGIGVEGVSGDEIVEGVAEDGGEGPVSAY* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK618659.1 | complete | 100 | 716-1018(+) |
Amino Acid sequence : | |||
| MTSPTSFASPRKTGTSQPSDASKTTSPQKVRPPTRRRIPSPERRSASATDPSSPTSRTPVTTATARNRAPTCPSSLSRNRLSSTTSRSPNTMPSSPTSRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,615.596 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 114.495 | ||
| aromaticity | 0.010 | ||
| GRAVY | -1.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.060 | ||
| turn | 0.440 | ||
| sheet | 0.120 | ||