| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK803277.1 | complete | 140 | 1-423(+) |
Amino Acid sequence : | |||
| MDYLAKVIDETMRRTSLFIPIFREAKVDTDINGYTVPKGWQVLVWTRGVHMDPEVHPNPKEFDPSRWDNRAKPGSYIPFGGGPWICPGADLTKLEIYIFLHYFLLYYKLELQNPDCPVAY LPVPRPSDNCIAKVIKVKNF* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,215.636 | ||
| Theoretical pI: | 7.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 29.521 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.236 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK803277.1 | complete | 140 | 1-423(+) |
Amino Acid sequence : | |||
| MDYLAKVIDETMRRTSLFIPIFREAKVDTDINGYTVPKGWQVLVWTRGVHMDPEVHPNPKEFDPSRWDNRAKPGSYIPFGGGPWICPGADLTKLEIYIFLHYFLLYYKLELQNPDCPVAY LPVPRPSDNCIAKVIKVKNF* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,215.636 | ||
| Theoretical pI: | 7.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 29.521 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.236 | ||
| sheet | 0.186 | ||