Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK840837.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
ASCLHLLRVFLYEYRNCNSLLTKKSVSNFLKRNKRLFFFLYNSHAYEYQSIFVFLRNQSFHLRSISSGALFTRVYFYGKIDYLQKVFTKHFKGILWFFKHPFLHYVRYQGKWILASKSKG TSLLMTKWKYYLVHFWQCHFSVWSQPRRIHINRLSNHPIDFMGFVFSVRLTPSVVRSQMLENSFLIENGIKKFDTLVPIGPLIRSLAKAKFCNVLGHPVSKPVWSDLSDSDIIDRFVRIC | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 28,604.219 | ||
Theoretical pI: | 10.148 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51130 | ||
Instability index: | 39.568 | ||
aromaticity | 0.175 | ||
GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
Helix | 0.425 | ||
turn | 0.221 | ||
sheet | 0.171 |