Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK924883.1 | internal | 180 | 2-541(+) |
Amino Acid sequence : | |||
SVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 19,851.294 | ||
Theoretical pI: | 8.423 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 18.737 | ||
aromaticity | 0.117 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.228 | ||
sheet | 0.239 |