Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MN056292.1 | complete | 125 | 334-711(+) |
Amino Acid sequence : | |||
MFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQTETGEI KTGIT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,163.252 | ||
Theoretical pI: | 9.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 25.816 | ||
aromaticity | 0.112 | ||
GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.208 | ||
sheet | 0.240 |