Acc_NO	ORF type	length	start-end position (strand +/-)
>MN056293.1	internal	235	2-706(+)
Amino Acid sequence :
KASAGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQTETGEIXXHYLNA
Physicochemical properties
Number of amino acids:		235
Molecular weight:		26,184.450
Theoretical pI:		8.552
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		37360 37610
Instability index:		25.721
aromaticity		0.124
GRAVY		-0.390
Secondary Structure Fraction
Helix		0.309
turn		0.202
sheet		0.253