| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN167236.1 | internal | 182 | 3-548(+) |
Amino Acid sequence : | |||
| AGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKAL RALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYEC | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,132.581 | ||
| Theoretical pI: | 6.961 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
| Instability index: | 25.059 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.220 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN167236.1 | internal | 182 | 3-548(+) |
Amino Acid sequence : | |||
| AGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKAL RALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYEC | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,132.581 | ||
| Theoretical pI: | 6.961 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
| Instability index: | 25.059 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.220 | ||
| sheet | 0.258 | ||