| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN167237.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| GFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALR ALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKN | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,201.704 | ||
| Theoretical pI: | 7.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 26.768 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.225 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN167237.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| GFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALR ALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKN | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,201.704 | ||
| Theoretical pI: | 7.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 26.768 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.225 | ||
| sheet | 0.237 | ||