Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MN167258.1 | internal | 182 | 3-548(+) |
Amino Acid sequence : | |||
VGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKAL RALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYEC | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,242.884 | ||
Theoretical pI: | 7.758 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 27.058 | ||
aromaticity | 0.121 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.220 | ||
sheet | 0.236 |