Acc_NO	ORF type	length	start-end position (strand +/-)
>MN186382.1	internal	194	583-2(-)
Amino Acid sequence :
TSYRAFLERTHFYGKMEHLVVVFQNDFQFFLWLFREPFMHYVRYRGKSILGSKGTLLLMNKWNYYLVNLWQCNFDLWSQLDRIYITQLANHYFYFLDYLSSVRLNPSVVRSQMLDNSFIM DIAIKKFDSIVPIISLIGSLAKAKFCNVSGHPISKPAWGDSSDSDIIDRFGRIYTNLYHYYSGSSKKNSLYRIK
Physicochemical properties
Number of amino acids:		194
Molecular weight:		23,047.320
Theoretical pI:		9.497
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		49850 49975
Instability index:		36.832
aromaticity		0.180
GRAVY		-0.120
Secondary Structure Fraction
Helix		0.418
turn		0.237
sheet		0.180