Acc_NO	ORF type	length	start-end position (strand +/-)
>MN380710.1	internal	185	1-555(+)
Amino Acid sequence :
LRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKS ILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQI
Physicochemical properties
Number of amino acids:		185
Molecular weight:		22,701.246
Theoretical pI:		10.223
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		61420 61545
Instability index:		48.263
aromaticity		0.178
GRAVY		-0.123
Secondary Structure Fraction
Helix		0.443
turn		0.222
sheet		0.205