Acc_NO	ORF type	length	start-end position (strand +/-)
>MN380711.1	internal	181	1-543(+)
Amino Acid sequence :
LRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKS ILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVV
Physicochemical properties
Number of amino acids:		181
Molecular weight:		22,216.696
Theoretical pI:		10.135
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		61420 61545
Instability index:		45.617
aromaticity		0.182
GRAVY		-0.102
Secondary Structure Fraction
Helix		0.448
turn		0.221
sheet		0.210