Acc_NO	ORF type	length	start-end position (strand +/-)
>MN380712.1	internal	183	1-549(+)
Amino Acid sequence :
TLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRK SILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVR
Physicochemical properties
Number of amino acids:		183
Molecular weight:		22,473.986
Theoretical pI:		10.223
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		61420 61545
Instability index:		45.227
aromaticity		0.180
GRAVY		-0.130
Secondary Structure Fraction
Helix		0.443
turn		0.219
sheet		0.208