| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN394897.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| TYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPP AYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFT | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,782.275 | ||
| Theoretical pI: | 6.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29130 | ||
| Instability index: | 30.881 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.225 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN394897.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| TYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPP AYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFT | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,782.275 | ||
| Theoretical pI: | 6.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29130 | ||
| Instability index: | 30.881 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.225 | ||
| sheet | 0.236 | ||