| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN445186.1 | complete | 479 | 1-1440(+) |
Amino Acid sequence : | |||
| MESFYVTLLTLFILLVSIFLHFLFFAKKSSGTAPLPPGKTGYPFVGESLEFLSTGWKGHPEKFIFDRITKYSSTVFRTHLLGEKAAVFCGAGGNKFLFSNENKLVQAWWPSSVDKVFPSS TQTSSKEEAIKMRRMLPNFFKPEALQRYVGIMDHIARRHFADSWENKEEVVTFPLTKNFTFWLAIRLFVSIEDPEMVEKFAEPFNLLASGLISIPIDLPGTPFHKAIKSSNLIRKELRLI IKQRKIDLAEGKASPTQDILSHMLLTSDESGKFMEEHDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYDGVYKEQMEIANSKPEGELLNWDDVQKMRYSWNVACEVLRLAPPLQGA FREALSDFMYNGFSIPKGWKIYWSANSTHRNPEVFPEPLKFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKWEKMIPDEKIVVDPMPIPAKGLPVRLFPHKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 479 | ||
| Molecular weight: | 12,864.442 | ||
| Theoretical pI: | 7.999 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 67.432 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.816 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.154 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN445186.1 | complete | 153 | 902-441(-) |
Amino Acid sequence : | |||
| MKAQAELAVSCPPISSPKILSAISCSSMNLPLSSLVKSICDNISCVGDAFPSAKSIFLCLIIRRSSFRIKFDDLIALWNGVPGKSIGIDIKPDANRLNGSANFSTISGSSMLTNSLMASQ NVKFFVRGNVTTSSLFSQLSAKCLLAMWSMIPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 12,864.442 | ||
| Theoretical pI: | 7.999 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 67.432 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.816 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.154 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN445186.1 | complete | 104 | 672-358(-) |
Amino Acid sequence : | |||
| MERCSWQIDWNRYQTGRQQVERLSELLHHLWILYADKQPDGEPEREVLRKRERYDFLLVLPAVREMPSGYVVHDPHVALQRLRFEEIRQHSSHFDSFFFRRSLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,864.442 | ||
| Theoretical pI: | 7.999 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 67.432 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.816 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.154 | ||
| sheet | 0.260 | ||