Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MN481072.1 | internal | 217 | 2-652(+) |
Amino Acid sequence : | |||
KAGVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEA | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 24,257.242 | ||
Theoretical pI: | 7.776 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 30.800 | ||
aromaticity | 0.124 | ||
GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.226 | ||
sheet | 0.240 |