| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN521401.1 | internal | 174 | 3-524(+) |
Amino Acid sequence : | |||
| AGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRA | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,316.794 | ||
| Theoretical pI: | 7.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 27.047 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.224 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN521401.1 | internal | 174 | 3-524(+) |
Amino Acid sequence : | |||
| AGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRA | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,316.794 | ||
| Theoretical pI: | 7.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 27.047 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.224 | ||
| sheet | 0.241 | ||