Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MN602448.1 | 3prime_partial | 111 | 1-333(+) |
Amino Acid sequence : | |||
MTLLVHEIVELYNSSEKKAMIATLFCITGLLVTRWVDSGHFPLSNLYESLMFLSWSFSIIHMIPYFRNHKNNLSAITAPSAIFTQGFATSGLLTEMHQSTILVPALQSQWL | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,562.522 | ||
Theoretical pI: | 6.486 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 51.885 | ||
aromaticity | 0.117 | ||
GRAVY | 0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.387 | ||
turn | 0.234 | ||
sheet | 0.297 |