| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN606017.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| SAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPF | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,353.920 | ||
| Theoretical pI: | 5.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
| Instability index: | 28.152 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.233 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN606017.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| SAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPF | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,353.920 | ||
| Theoretical pI: | 5.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
| Instability index: | 28.152 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.233 | ||
| sheet | 0.248 | ||