| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN686218.1 | complete | 310 | 1-933(+) |
Amino Acid sequence : | |||
| MAEKSKILIIGGTGYIGKFIVEASAKSGHPTFALLRESAVSDPAKSQLIEGFKSSGVTILIGDLNDYESLVKAVKQVDVVISTVGALQLGDQKNIIAAIKEAGNIKRFYPSEFGNDVDRT RAVEPAKSAFAEKAKIRRAIEASGIPYTFVSSNYFAGYSLPTLSQPGLFAPPPPKDKIFIYGDGTAKAVFNDEHDIGTYTIKSVDDPRTVNKVMYIKPPKNIYSFNELVALWEKKIGKTV EKEYLPEDKLLKMIEESPIPVNVILAINHSTYVKGDQTYFEIDPSVAVEASELYPDVKYTTVEEYLSNFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 310 | ||
| Molecular weight: | 18,092.481 | ||
| Theoretical pI: | 7.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 27.315 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.213 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN686218.1 | 5prime_partial | 160 | 933-451(-) |
Amino Acid sequence : | |||
| SDKVAEVFLHGGVFDIGIQLRSLNRDGRVDFEVGLVALHVGRVVDCQYDVHRNWRFLNHLQQFVLWQVLFLNGLTNLLLPQGNQLVERIYVLRGLDVHHLVHSSRIVHRLDGVGADVMLV VEHSFSSSIAVNENFVLGRRRSEEARLGQRGQRIAGEVVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,092.481 | ||
| Theoretical pI: | 7.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 27.315 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.213 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN686218.1 | complete | 310 | 1-933(+) |
Amino Acid sequence : | |||
| MAEKSKILIIGGTGYIGKFIVEASAKSGHPTFALLRESAVSDPAKSQLIEGFKSSGVTILIGDLNDYESLVKAVKQVDVVISTVGALQLGDQKNIIAAIKEAGNIKRFYPSEFGNDVDRT RAVEPAKSAFAEKAKIRRAIEASGIPYTFVSSNYFAGYSLPTLSQPGLFAPPPPKDKIFIYGDGTAKAVFNDEHDIGTYTIKSVDDPRTVNKVMYIKPPKNIYSFNELVALWEKKIGKTV EKEYLPEDKLLKMIEESPIPVNVILAINHSTYVKGDQTYFEIDPSVAVEASELYPDVKYTTVEEYLSNFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 310 | ||
| Molecular weight: | 18,092.481 | ||
| Theoretical pI: | 7.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 27.315 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.213 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN686218.1 | 5prime_partial | 160 | 933-451(-) |
Amino Acid sequence : | |||
| SDKVAEVFLHGGVFDIGIQLRSLNRDGRVDFEVGLVALHVGRVVDCQYDVHRNWRFLNHLQQFVLWQVLFLNGLTNLLLPQGNQLVERIYVLRGLDVHHLVHSSRIVHRLDGVGADVMLV VEHSFSSSIAVNENFVLGRRRSEEARLGQRGQRIAGEVVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,092.481 | ||
| Theoretical pI: | 7.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 27.315 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.213 | ||
| sheet | 0.231 | ||