Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MN722166.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
SSLHLLRLFLHEYSNWNSIITPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEAFANDFSATPWFFKAPFMHYVRYRGKSILTSKDT PLLMNKWKYYLIYLWQCSFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNSFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHICR NLSHYYSGSSKKKGLYRIKYILQLSCVK | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 31,501.485 | ||
Theoretical pI: | 9.831 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56840 57090 | ||
Instability index: | 41.418 | ||
aromaticity | 0.160 | ||
GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.399 | ||
turn | 0.261 | ||
sheet | 0.213 |