| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN731742.1 | 5prime_partial | 236 | 1-711(+) |
Amino Acid sequence : | |||
| PMDNQQNLVTAQGRTDPNENTGTSIQNCQIIPAADLVPVEASIPSYLGRPWQLYSRTVVMQSYIDSHISAKGWSVWDGDFALSTLFYGEYMNKGPGAGLAGRVTWPGYKGSIATNTANLF TVATFIQGGSWLEMDSDANPGSHVDHVQTLLSAERNYQYTCLDCFAYVGKPSLIYCSIEQLSGHVSHLDRNSLAMMKKIQRQKPSHPRREALEGYGEVAEGFPVWVSGKDDDSLYI* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 15,295.477 | ||
| Theoretical pI: | 11.092 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 70.462 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.515 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MN731742.1 | complete | 137 | 1092-1505(+) |
Amino Acid sequence : | |||
| MQLRGLPRYYLRPLPASVLHPRSMRSDHRLIINKRRSRAPRGELVRPEALIQPEEHLHGAGPRGSEHIYIINLSELQGRGGLRPGAVLCRLRALPRQAVEHSLEDGVVDSVVPQPDQPGG VARVGRRLRAALQDPEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,295.477 | ||
| Theoretical pI: | 11.092 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 70.462 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.515 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.292 | ||