Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MN747929.1 | 5prime_partial | 296 | 2-892(+) |
Amino Acid sequence : | |||
AVSTLPDMFPALGFIPILSGKKAFLQNIQKEADKILDYIIDEHIQRTKSKDYDGKESDKEDIVDVLLRLEKTGELEIPITTQDIKAVIWSVFAGGTDTSSTTTLWAMSELMRNPKVMEKV QAEVREKLKGKKEILEADIQDLPYMRAVIKETLRLRIPGPLLLPRETMEPIEVDGYVIPEKTKILFNAWAVTRDPELWENPESFIPERFIEKQIDFKGTNYEFTPFGSGRRICPGMNFGI ANVELPLAKLLYYFNWQLPHGMKPEDLDMTAKFGVVCGRKNDLFLIPTPYNIEGQN* | |||
Physicochemical properties | |||
Number of amino acids: | 296 | ||
Molecular weight: | 33,825.751 | ||
Theoretical pI: | 5.122 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39545 | ||
Instability index: | 34.475 | ||
aromaticity | 0.091 | ||
GRAVY | -0.308 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.203 | ||
sheet | 0.270 |