Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MN904279.1 | internal | 193 | 2-580(+) |
Amino Acid sequence : | |||
KVRMICDCQAPPVKVVQDKRLAQPLSLCGSTMRSPHGCHAQYMANMGTIASLVMSVTINEDDEETVNDQQIGRKLWGLVVCHHTNPRFVPFPLRYACEFLMQVFGVQVNREVELAAQTKE KHILQTQTVLCDMLLRDAPVAIVTRSPNVMDLVKCDGAALYYRKKFWMLGVTPTEAQIKDITEWLLEYHGEST | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,851.233 | ||
Theoretical pI: | 6.644 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24450 | ||
Instability index: | 50.173 | ||
aromaticity | 0.067 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.166 | ||
sheet | 0.264 |