Acc_NO	ORF type	length	start-end position (strand +/-)
>MS687900.1	complete	300	1-903(+)
Amino Acid sequence :
MDKAEGRAPVTLGKSLLVPSVQELARKPLATVPQRYVREDHQDDPSLLKHTCAPTSPLPSLPVIDLKCLLDSQSAGSELEKLHFACKDWGFFQLVNHGVSTWLVEKVKSQTQDFFNLSIE EKQKFWQQPGEIEGFGQAFVVSEEQKLDWADMFFMTTLPKYLRKPHLFPMLPLHFRETMEEYSLELKNLAMTILEMMAKALKIETEELKLLFDDGLQAMRMNYYPPCPQPEQVIGLTPHS DAVGLTILLQVNEMEGLQIRKDGMWVPVNPLPNAFVVNIGDILEVTTTYIYLYIYNIIII*
Physicochemical properties
Number of amino acids:		300
Molecular weight:		11,090.641
Theoretical pI:		8.879
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14480
Instability index:		32.888
aromaticity		0.120
GRAVY		-0.022
Secondary Structure Fraction
Helix		0.290
turn		0.350
sheet		0.140

Acc_NO	ORF type	length	start-end position (strand +/-)
>MS687900.1	complete	100	578-276(-)
Amino Acid sequence :
MVIARFFNSNEYSSIVSLKCRGSIGNKWGFLKYLGNVVMKNMSAQSSFCSSETTNACPNPSISPGCCQNFCFSSIDRLKKSCVCDFTFSTNQVLTPWLTN*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		11,090.641
Theoretical pI:		8.879
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14480
Instability index:		32.888
aromaticity		0.120
GRAVY		-0.022
Secondary Structure Fraction
Helix		0.290
turn		0.350
sheet		0.140