Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT032187.1 | complete | 217 | 1-654(+) |
Amino Acid sequence : | |||
MVNPPGSNNTFFLAGAGNRGLEIEGKFVKFTAIGVYLEESAIPFLAAKWKGKSSEELTHSAEFFRDIVSGPFEKFTRVTMILPLTGKQYSEKVAENCVAYWKAIGTYTDAESQAIEKFVN VFQSETFPPGASILFTQSPLGSLTISFSKDDSVPGIGNAVIENKQLSEAVLDSIIGKHGVSPAAKCSIAKRVTELLEKSNAEAPVCEKPESELSSIQ* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 23,433.341 | ||
Theoretical pI: | 5.230 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 47.150 | ||
aromaticity | 0.092 | ||
GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.276 | ||
sheet | 0.267 |