Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT045995.1 | complete | 196 | 656-66(-) |
Amino Acid sequence : | |||
MKKKGFGRMISSVRSPPTRARLPLAVVINCGHRRVEIVELCEVHGVEILTPVRGVDGLPPELLEQDKHEPVDSCRRPRTLVAHDLLPIAYSGAPRNIYYQPVQIFPQVWIAWTWGIRVHH HQSVEIPIVTATNLNPRLMNHLRWPELFPIGDLSRGVGHPKGYASRERSHHLSNYPTDNQRIRFSSSCGHMETLAL* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 20,129.454 | ||
Theoretical pI: | 6.413 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 42.624 | ||
aromaticity | 0.117 | ||
GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.274 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT045995.1 | complete | 179 | 87-626(+) |
Amino Acid sequence : | |||
MAAATRETDPLIVGGIVGEVVGSFTRSIPLRVTYSSREVTNGKEFRPSQVVHQPRVEIGGCDYRNFYTLVMVDPDAPSPSNPHLREYLHWLVIDIPGSTGVSYGQEIMCYESPRPAAGIH RFVFILFQQLGRQTVYAPDWRQNFNTMDFAELYNLNSPVAAVYYNCQRESGSGGRRTYA* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 20,129.454 | ||
Theoretical pI: | 6.413 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 42.624 | ||
aromaticity | 0.117 | ||
GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.274 | ||
sheet | 0.196 |