Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT238097.1 | internal | 204 | 2-613(+) |
Amino Acid sequence : | |||
AGVKDYRLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEESQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALR LEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRF | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,877.551 | ||
Theoretical pI: | 5.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34505 | ||
Instability index: | 35.910 | ||
aromaticity | 0.123 | ||
GRAVY | -0.447 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.235 | ||
sheet | 0.230 |