| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT385740.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| SMSPQTETKASVGFKAGVKDYKLTYYTPEYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTS IVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAXNYGRAVYECLRGGLDFTS | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,102.806 | ||
| Theoretical pI: | 6.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 34.196 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.249 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT385740.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| SMSPQTETKASVGFKAGVKDYKLTYYTPEYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTS IVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAXNYGRAVYECLRGGLDFTS | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,102.806 | ||
| Theoretical pI: | 6.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 34.196 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.249 | ||
| sheet | 0.239 | ||