Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT512039.1 | complete | 361 | 1-1086(+) |
Amino Acid sequence : | |||
MASAPIHAGATPEEEEEKALFLSAMRLTSAAGLPMVVKAAIELDVLEIIARAGPGAQLSASEIASRIPGAASSEAPAVLDRMLRFLACHSVLTSTSVDGKERRYGLAPVCRFLTRDKDGA SIGDVVLVDLDPVLLACWEQMKYLVLEGISPFTKAHGTTAFEYHGVNPRINKVFNNAMASNSTIILRKILEIYKGFEGVTQLVDVGGGLGITLKMIISKYPHIKGINYDLPHVISDAPTL PGVENIGGDMFVEIPSASTIFMKWILHDWSDEHCLKILKNCWKALPNGGKAIIMEAILPETPKTDAASQEAFYSDLCMLISNVGGKERTRNEFKSLAMDAGFTKFETVSCALNIWVMELT K* | |||
Physicochemical properties | |||
Number of amino acids: | 361 | ||
Molecular weight: | 14,157.786 | ||
Theoretical pI: | 6.129 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 31.154 | ||
aromaticity | 0.116 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.223 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT512039.1 | 3prime_partial | 210 | 632-3(-) |
Amino Acid sequence : | |||
MPRPPPTSTSCVTPSKPLYISRIFLRMIVELLAMALLKTLFILGFTPWYSNAVVPWALVNGLIPSSTRYFICSQQARRTGSRSTRTTSPMDAPSLSLVRNLHTGARPYRLSLPSTDVDVS TEWHARNLSIRSSTAGASELAAPGIRDAISDAESCAPGPALAMISSTSSSMAALTTIGRPAAEVRRMAERKSAFSSSSSGVAPAWIGAEA | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 14,157.786 | ||
Theoretical pI: | 6.129 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 31.154 | ||
aromaticity | 0.116 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.223 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT512039.1 | 5prime_partial | 152 | 3-461(+) |
Amino Acid sequence : | |||
GLCSDPCRSHPGRGRGEGTLPLRHAPHLGSRPPDGRQGGHRARRAGDHRQGRPGRAALGIRDRVPYTGSRQLGGSRRARPDAEVPRMPFRADIDVRRRQGEAVRPGAGVQVPDEGQGRSI HWRRGPCRPGSCPPRLLGTNEISCTRGDQSVH* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 14,157.786 | ||
Theoretical pI: | 6.129 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 31.154 | ||
aromaticity | 0.116 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.223 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT512039.1 | complete | 121 | 801-436(-) |
Amino Acid sequence : | |||
MENPLHKDGARTWNFHEHVSSNVLHSWKSWGIRDNMRQIIIDSFDVRVLGDYHFKRDAKTPSNINELCNTFKAFVYLQDFSEDDRGVASHGIIEDLIYSWIHTMVLKCCRSVGFSERTDP L* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,157.786 | ||
Theoretical pI: | 6.129 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 31.154 | ||
aromaticity | 0.116 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.223 | ||
sheet | 0.174 |