Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT512041.1 | complete | 297 | 1-894(+) |
Amino Acid sequence : | |||
MSHEAAAVEEVNKGIADLYDEMTVVMETLWGDHMHHGFYDVGVPTRSLPDHQTAQIRMIEEALRFAGVSDDPSKKPKRILDVGCGIGGSSLYLAKKYGAKCHGINLSPFQIQRAQSLAMS AGLTDKVSFEIADAQNQPFPDGHFDLVWVLETAEHMPEKSKFIGELARVTAPGGIVIITSWCQRDLLPSEVSLRPDEVSLLNKLSESHHLPKWCSPSEYVKLAESSSFKDIKTADWTEHV APHWNVAMRPVLTWKGITFILRSGWKMAKGLLAMPIVSEGREKKIIKYAILTFRKPE* | |||
Physicochemical properties | |||
Number of amino acids: | 297 | ||
Molecular weight: | 33,147.805 | ||
Theoretical pI: | 6.464 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 53190 | ||
Instability index: | 50.523 | ||
aromaticity | 0.081 | ||
GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.222 | ||
sheet | 0.273 |