| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512046.1 | complete | 364 | 1-1095(+) |
Amino Acid sequence : | |||
| MASAPNHAGATPADQEEEEKALFISAMRLTSAVGLPMVVKVVIELDVLEIIARAGPGAQLSPSEIASRIPGAASSEAPAVLDRMLSFLASHSVLTWSTSADGKERRYGLAPVCRFLTRDK DGASLGDMTLGSLDPVFLACWEQMKYAVLEGAIPFTKAHGMTAFEYHGVNPRMNKVFNRAMASGSTIILRKILDSYKGFEGVSNLVDVGGGAGATLSMIISKYPHIKGINFDLPHVVSNA LPLPGVEHVGGDMFVEIPRGNTILMKWILHDWTDEHCLKILKNCWKALPDTGKVIIIEAILPETPKTDDASQEVFYSDLAMLIYNSGGKERTEKEFKSLAADAGFTKFEIVTSAFNVWVM ELTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 364 | ||
| Molecular weight: | 12,620.924 | ||
| Theoretical pI: | 11.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 55.760 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.970 | ||
Secondary Structure Fraction | |||
| Helix | 0.144 | ||
| turn | 0.297 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512046.1 | complete | 203 | 653-42(-) |
Amino Acid sequence : | |||
| MLSVAPAPPPTSTRFDTPSKPLYESKIFLRMIVEPLAMALLKTLFILGLTPWYSNAVIPCALVKGIAPSSTAYFICSQQARKTGSRLPRVMSPRDAPSLSLVRNLHTGASPYRLSFPSAD VDHVSTEWLARKLSIRSSTAGASELAAPGILDAISDGESCAPGPALAMISSTSSSMTTLTTIGRPTAEVSRMAEMNSAFSSSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 12,620.924 | ||
| Theoretical pI: | 11.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 55.760 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.970 | ||
Secondary Structure Fraction | |||
| Helix | 0.144 | ||
| turn | 0.297 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512046.1 | 5prime_partial | 118 | 3-359(+) |
Amino Acid sequence : | |||
| GLCSEPCWSHPGRSGGRGEGAVHLRHAAHLGSRPPDGRQGCHRARCAGDHRQGRPGRAALPIRDCVQDTGSRQLGGSRRARPDAEFPRQPLRADVVDVRRRKGEAVRAGAGVQVPDEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,620.924 | ||
| Theoretical pI: | 11.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 55.760 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.970 | ||
Secondary Structure Fraction | |||
| Helix | 0.144 | ||
| turn | 0.297 | ||
| sheet | 0.203 | ||