| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512054.1 | complete | 527 | 1-1584(+) |
Amino Acid sequence : | |||
| MQAMASFANLSSSSLLQLPSTSAHHPHHLPFRPRRISAVHAAEPAKNPAVSDKISPAPAPAPPRPGKWSVDSWRSRPALQLPEYPNKEELNSVLHTIESFPPIVFAGEARHLEERLADAA LGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVIKVGRMAGQFAKPRSDAMEEKDGVKLPSYRGDNVNGDAFDEKSRIPDPERMIRAYCQSAATLNLLRAFATGGYA AMQRVTQWNLDFTQHSEQGDRYRELAHRVDEALGFMSAAGLTVDHPIMTTTDFWTSHECLLLPYEQALTREDSTTGFFYDCSAHMLWVGERTRQLDGAHVEFLRGVANPLGIKVSDKMDP RELVKLIEILNPRNKAGRITIITRMGAENMRVKLPHLIRAVRGAGQIVTWVSDPMHGNTIKAPCGLKTRPFDAIRAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLS SRYHTHCDPRLNASQSLELAFIIAERLRRRRISSPPDLLSTLPQLEF* | |||
Physicochemical properties | |||
| Number of amino acids: | 527 | ||
| Molecular weight: | 14,029.964 | ||
| Theoretical pI: | 7.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 42.305 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.287 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512054.1 | 5prime_partial | 189 | 2-571(+) |
Amino Acid sequence : | |||
| CKQWRLSPTSPPPLSSNSLPPPLTTPTISPSVPAGSPPSTRRSRRRTPPSPTRSLRRPRPRRRGRGNGPLTVGGRGPPSSCPSTRTRRSLIRSSTRSRASPPSCSPARPATSRSASPTLL SAKPSSCREETAPRASKSSTPTTSVTPSVSSSRWASSSCSAARCPSSRSGGWQGSLRSRGRMRWRRRTG* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 14,029.964 | ||
| Theoretical pI: | 7.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 42.305 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.287 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512054.1 | complete | 144 | 1403-969(-) |
Amino Acid sequence : | |||
| MHSVTFCPVISRCTPPGWLPSCSCTSKKARTSARIASKGRVLRPQGALMVLPCMGSLTQVTIWPAPRTARIRWGSFTRMFSAPIRVIIVILPALFRGFRISISFTNSLGSILSLTLIPRG FATPRRNSTWAPSSWRVRSPTQSM* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,029.964 | ||
| Theoretical pI: | 7.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 42.305 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.287 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512054.1 | complete | 143 | 500-69(-) |
Amino Acid sequence : | |||
| MTGIWPPNMRTTPIWRRIRKVSRMLLALNSLKLSAQSPPCRRKALPRAASARRSSRWRASPANTMGGKLSIVWRTELSSSLFGYSGSWRAGLDLQLSTDHFPGRGGAGAGAGEILSETAG FFAGSAAWTAEIRRGRKGRWWGW* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 14,029.964 | ||
| Theoretical pI: | 7.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 42.305 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.287 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT512054.1 | complete | 129 | 1353-964(-) |
Amino Acid sequence : | |||
| MAPFLLMHIKEGSHLRPDCVKGASLEATRGLDGVAMHGITDPGNDLASPPNSTDKMGKLHPHVLCPHSCDYSNPPSLVPRVQNLDQLHQLPRIHLITHLNSKRICNTTEELHVGTVKLAG AFSDPKHVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,029.964 | ||
| Theoretical pI: | 7.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 42.305 | ||
| aromaticity | 0.023 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.287 | ||
| sheet | 0.240 | ||