Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT643184.1 | internal | 287 | 2-862(+) |
Amino Acid sequence : | |||
LTYVSDVQISYPIHLEKLVQTLRYWVKDTSSLHLLRFFLHEYWNWNSLIFPNNLISFFAKSNPRLFLFLYNSHVYEYESIFFFLRKQSFHLRSTFFRVLLERIYFFGKIEHFAEVFANDF QAILWLFKDPFMHYVRYQGKSILASKDTPLLLKKWKYYLVNLCQCHFSVWFQPAKICINPLSKQSLDFLGYLSSLRLNLSVVRSQMLENAFLIDNAMKKVDTRIPIIPLIRSLAKTKFCN AAGHPISQPIWAGSSDSDIINRFVRICRNLSHYYSGSSKKKSLYRIK | |||
Physicochemical properties | |||
Number of amino acids: | 287 | ||
Molecular weight: | 34,167.523 | ||
Theoretical pI: | 9.767 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 62340 62590 | ||
Instability index: | 33.121 | ||
aromaticity | 0.171 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.429 | ||
turn | 0.216 | ||
sheet | 0.213 |