| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT762127.1 | complete | 315 | 1-948(+) |
Amino Acid sequence : | |||
| MVVDNKISKILIFGGTGYLGKHLVRASIKLGHPTYVYSRPDSNKTDILDEFRSMGVTIIKGMINDHEKLVMAVRNVDVVISTLPYPQVFDQLKIVEAIKLAGNIKRFLPSDFGVEEDRVS VLPPFEAFLEKKRQIRRAIEEARIPYTFISANCYAAYFINYLLRPSEEKDEITVYGSGEAKTVMNSEEDIGIYTIKVATDPRTCNRIVIFRPPTNVVSQRDLISLWEKKTGKTFKKIHIP EEEIVALSQTLPDPDNIPVSIIHSVFIKGVTANFDLKGDDVEASSLYPDLRFSTVDELLDVFRFNPPEPAAAAFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 315 | ||
| Molecular weight: | 35,529.476 | ||
| Theoretical pI: | 5.702 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 40.160 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.216 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MT762127.1 | complete | 315 | 1-948(+) |
Amino Acid sequence : | |||
| MVVDNKISKILIFGGTGYLGKHLVRASIKLGHPTYVYSRPDSNKTDILDEFRSMGVTIIKGMINDHEKLVMAVRNVDVVISTLPYPQVFDQLKIVEAIKLAGNIKRFLPSDFGVEEDRVS VLPPFEAFLEKKRQIRRAIEEARIPYTFISANCYAAYFINYLLRPSEEKDEITVYGSGEAKTVMNSEEDIGIYTIKVATDPRTCNRIVIFRPPTNVVSQRDLISLWEKKTGKTFKKIHIP EEEIVALSQTLPDPDNIPVSIIHSVFIKGVTANFDLKGDDVEASSLYPDLRFSTVDELLDVFRFNPPEPAAAAFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 315 | ||
| Molecular weight: | 35,529.476 | ||
| Theoretical pI: | 5.702 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 40.160 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.216 | ||
| sheet | 0.222 | ||