Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MT782383.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
EYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQTETGEIKGHYLNATAGTCE | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,887.032 | ||
Theoretical pI: | 6.997 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
Instability index: | 25.061 | ||
aromaticity | 0.122 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.200 | ||
sheet | 0.252 |